LL-37 Peptide: Charge, Helix Formation and HPLC Analysis

The LL-37 peptide is one of the more demanding compounds a peptide lab can take into inventory. It is long for a research peptide at 37 residues, it carries a heavy positive charge, and its shape changes with whatever it is dissolved in. Those three properties explain most of what goes wrong with it: poor recovery from dilute solutions, broad or tailing peaks, turbid stock solutions and purity numbers that do not agree between labs. This guide sets out the chemistry behind each problem and what a QC or procurement team should look for on paperwork and at the bench.

What the LL-37 peptide is

LL-37 is the 37-residue C-terminal segment of hCAP18, the human cathelicidin precursor protein. It takes its name from the two leucines at its N-terminus and its length. Its sequence is:

[LL-37, 37 aa]

In the research literature, LL-37 is studied mainly in vitro as a membrane-active antimicrobial peptide and as a model amphipathic helix. Several shorter fragments derived from it also appear in papers, such as KR-12 (residues 18 to 29) and FK-16 (residues 17 to 32). These are separate compounds with their own masses, and a certificate for one says nothing about another.

A charge of roughly +6 and what it causes

Eleven basic side chains against five acidic ones leave LL-37 with a net charge of about +6 at neutral pH. That single fact drives three practical problems.

Tailing on silica columns

Protonated arginine and lysine side chains interact with leftover silanol groups on silica-based C18 packings, which drags out the back of the peak. Trifluoroacetic acid in the mobile phase masks that interaction and is the standard choice for this peptide. Methods that swap TFA for formic acid to suit a mass spectrometer tend to give visibly worse peak shape, so a broad LL-37 peak on a formic acid method is not by itself evidence of poor material.

Loss to container surfaces

A strongly cationic peptide sticks to glass and to some plastics, and the effect is proportionally worst in dilute solution. The symptom is low recovery rather than anything visible. For analytical work, low-binding tubes, avoiding very dilute intermediate solutions and preparing working concentrations close to use all reduce the loss.

Counter-ions in the weighed mass

Every basic group can carry a counter-ion, and LL-37 has a dozen of them including the N-terminal amine. Supplied as a TFA or acetate salt, a meaningful share of the weighed powder is counter-ion rather than peptide. For a lab preparing standards from many vials, the net peptide content figure on the certificate, where one is given, is what converts weighed milligrams into peptide milligrams.

Helix or coil depends on the solvent

Dissolved in plain water with little salt present, LL-37 has no settled structure. Add salt, move to a physiological-strength buffer or introduce a negatively charged surface such as a lipid membrane, and it folds into an amphipathic alpha-helix with hydrophobic residues on one face and charged residues on the other.

This is more than a structural curiosity. The helical form self-associates more readily, adsorbs differently and can elute differently. The same lot may therefore behave one way in water and another in a buffer. Circular dichroism is the usual measurement of helicity, and it sometimes appears in LL-37 characterisation packages where it would add little for a short linear peptide.

Aggregation in concentrated stocks

The same amphipathic arrangement that stabilises the helix encourages molecules to cluster together at higher concentration. Concentrated solutions can turn faintly cloudy, or can form small oligomers that pass a visual check but still change the chromatogram, typically as a broadened main peak or an early shoulder.

A few habits help when preparing analytical solutions:

• Dissolve first in slightly acidic water, where it dissolves more readily and stays mostly unfolded, then dilute into buffer.
• Avoid holding concentrated stocks longer than necessary.
• Record the solvent and concentration with any purity result, because a figure measured on partly aggregated material describes the aggregate as well as the peptide.

Detecting LL-37: 214 nm and the charge envelope

With four phenylalanines and no tryptophan or tyrosine, LL-37 has almost no absorbance at 280 nm. Detection is at 214 nm, which responds to every peptide bond. That is the more demanding wavelength for baseline quality, but it is also the more honest one: truncated sequences and fragments missing the phenylalanines still show up.

In positive electrospray, the peptide picks up many protons and spreads across a broad charge-state series. Working from the average mass, the main ions fall near:

• 4+ at about m/z 1124.3
• 5+ at about m/z 899.7
• 6+ at about m/z 749.9
• 7+ at about m/z 642.9

Software deconvolutes that series back to a neutral mass. At about 4.5 kDa the monoisotopic peak is a small part of the isotope cluster, so compare the reported result with the calculated average mass, and check which of the two the certificate is quoting.

Degradation routes to watch in stored material

LL-37 contains no cysteine or methionine, so the familiar oxidation products are not a concern. Its weak points lie in other residues:

1. Asparagine at position 30 is prone to deamidation, which adds about 1 Da.
2. The two aspartates can pass through a succinimide intermediate and isomerise to isoaspartate, with no change in mass at all.
3. Proteolytic clipping. Many arginine and lysine residues make it an easy substrate for trypsin-like proteases if a sample becomes contaminated.

Because the first two changes are nearly or completely invisible to intact mass, a stability comparison across a long-held order depends on chromatography. Growth of a shoulder or a late-eluting peak between the certificate and a later in-house run is the signal to look for.

What to ask for when ordering in volume

• A deconvoluted average mass close to the calculated 4493.3 Da.
• A chromatogram at 214 nm, run with TFA as the ion-pairing agent, with the method stated.
• The counter-ion and, where available, net peptide content.
• The solvent used to prepare the analytical sample.
• A single lot for the order where possible, so every vial is covered by the same data.

Bulk Peptides does not list LL-37 at present; the points above are offered as a general specification for any lab sourcing it. Related background is in our articles on isoelectric point and solubility and net peptide content.

LL-37 is discussed here strictly as an in-vitro research material. Nothing in this article refers to use in humans or animals.